HDAC-Inhibitoren als Therapie für neuronale Erkrankungen. Entdeckung neuer Anwendungsgebiete

  • Published on
    06-Jul-2016

  • View
    212

  • Download
    0

Embed Size (px)

Transcript

  • Entdeckung neuer Anwendungsgebiete

    HDAC-Inhibitoren als Therapiefr neuronale ErkrankungenANDRE FISCHER

    Chromatin-Plastizitt: Regulierung derUmwelt-Genom-Interaktion

    Das menschliche Genom besteht aus 23 Chromosomen-paaren und codiert in jeder somatischen Zelle unseres Kr-pers die gleichen Gene. Jede Zelle transkribiert allerdingsnur einen Bruchteil dieser Gene in mRNA, welche letztlichin Proteine translatiert wird. Gene knnen demnach aktivoder inaktiv sein und bestimmen so mageblich den Ph-notyp einer Zelle. Die Gesamtheit der aktiven Gene (dasTranskriptom) unterscheidet sich also wesentlich zwischenverschiedenen Zelltypen, wie z.B. Leber- oder Nerven-zellen.

    Darber hinaus reagiert ein Organismus auf vernderteUmweltbedingungen mit vernderter Genexpression. Insbe-sondere Nervenzellen zeichnen sich durch eine sehr hohePlastizitt aus, d.h. in Antwort auf Umweltreize sind in Ner-venzellen rasche Vernderungen der Genexpression zu beo-bachten. Diese vernderte Genexpression ist essentiell frLernprozesse und die Abspeicherung von Langzeitgedcht-nisinhalten ist ohne differenzielle Genexpression nicht mg-lich [1].

    Jngste Daten weisen darauf hin, dass eine deregulierte His-ton-Acetylierung in eine Reihe von neurodegenerativen undkognitiven Erkrankungen involviert ist. Histondesacetylase-Inhibitoren gelten daher als aussichtsreiche therapeutischeStrategie fr so unterschiedliche neuronale Erkrankungen wieChorea Huntington, Morbus Alzheimer oder Schizophrenie.Dieser Artikel stellt die wichtigsten Ergebnisse dieses neuenForschungsgebiets zusammen.

    204 | Pharm. Unserer Zeit | 3/2010 (39) 2010 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim

    DOI:10.1002/pauz.201000367

    A B B . 1 H I S TO N - AC E T Y L I E R U N G R EG U L I E R T

    G E N E X PR E S S I O N

    AMe

    Me

    ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH 2 4 9 10 14 18 23 2628 36

    H3Me Me ACP AC MeAC AC MeMeP Me

    K79

    SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAR 1 3 5 8 12 16 20

    PMe AC AC MeAC AC

    H4

    SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNY 1 5 9

    P AC AC

    H2A

    PEPAKSAPAPKKGSKKAVTKAQKKDSKKRKRSRKESYSV 5 12 14

    PAC AC

    H2B

    B

    H4H2BH2AH3

    H4

    H2BH2AH3

    H4HDNA

    Aktive Gene

    H4H2BH2AH3

    H4

    H2BH2AH3

    H4HDNA

    Inaktive Gene

    HATs HDACs

    Phosphorylierung Acetylierung MethylierungP AC Me

    ACAC

    AC

    AC

    AC

    AC

    AC

    ACACAC

    ACAC

    ACAC

    AC ACAC AC

    AC

    AC

    ACAC

    ACAC

    > A. Die basischen N-terminalen Bereiche der Histone sindzahlreichen posttranslationalen Modifikationen unterwor-fen. Hierbei handelt es sich insbesondere um Lysin-Acetylie-rungen, Lysin- oder Arginin-Methylierungen sowie Serin-Phosphorylierungen. B. Diese Modifikationen beeinflussendie Interaktion des Histonkomplex mit der DNA oder rekru-tieren weitere Proteine und regulieren so die Genexpression. (HDAC: Histondesacetylase; HAT: Histonacetyltransferase)

  • T H E R A P I E F R N E U R O N A L E E R K R A N K U N G E N | K L I N I K

    Daher gibt es strenge Kontrollmechanismen, welche da-rber entscheiden, wann, wo und wie stark ein Gen expri-miert wird. Neben der Aktivitt von Transkriptionsfaktorenhat die dreidimensionale Struktur des Chromatins einen we-sentlichen Einfluss auf die Aktivitt von Genen und ist einessentielles Bindeglied zwischen Umwelt und Genom. AlsChromatin bezeichnet man die Gesamtheit von DNA undden daran gebundenen Proteinen. Ist dieses stark konden-siert, nennt man es Heterochromatin, welches mit redu-zierter Genexpression assoziiert ist. Offeneres Chromatinbezeichnet man als Euchromatin, aus dem dann Gene ab-gelesen werden knnen. Chromatin ist also extrem plastisch.

    Die Chromatinplastizitt wird vor allem durch Histon-proteine vermittelt. Zusammen mit der DNA bilden dieseals kleinste strukturelle Einheit des Chromatins dieNucleosomen. Ein Nucleosom ist ein oktamerer Komplexaus jeweils zwei der vier kanonischen Histone (H2A, H2B,H3 und H4), um welche sich 147 Basenpaare DNA winden.Zustzlich gibt es noch Histon 1 (H1), welches als so ge-nannter Linker funktioniert und den Aufbau von Nucleo-somen zu greren und kompakteren Strukturen reguliert(Abb. 1).

    Histone sind hoch konservierte, basische Proteine, dieaus einer globulren und einer flexiblen Domne bestehen.Aminosuren in der flexiblen N-terminalen Domne der His-tone, insbesondere die von Histon H3 (H3) und H4, kn-nen posttranslational modifiziert werden. Die hufigstenModifikationen an Histonen sind die Acetylierung von Ly-sin (K) oder die entsprechende Methylierung. Daneben sindauch Phosphorylierung, Ubiquitinierung, Sumoylierung,ADP-Ribosylierung und Biotinylierung beschrieben worden(Abb. 1) [2].

    Bestimmte Modifikationen korrelieren dabei mit aktiverGenexpression, wie z.B. Acetylierung an H3K9 und H3K14oder H4K5, H4K8, H4K12, H4K16, wohingegen andere Mo-difikationen, wie z.B. die H3K27-Methylierung die Gen-expression unterdrcken. Zustzlich gibt es zumindest frH3 und H2A verschiedene Proteinvarianten, wodurch sichdie Komplexitt der Regulationsmglichkeiten noch erhht.Manche Modifikationen sind transient, whrend andereeher permanent sind und vererbt werden knnen.

    Jede Histonmodifikation wird durch entsprechend ent-gegen gesetzte Aktivitten von Enzymen reguliert, welchedie Modifikationen anfgen oder abspalten. Histon-Acety-lierung wird durch Histonacetyltransferasen (HAT) kataly-siert, wohingegen Histondesacetylasen (HDAC) diese Ace-tylgruppen wieder abspalten (Abb. 1). hnlich regulierenHistonmethyltransferasen und -demethylasen die Methylie-rung von Histonen.

    Vernderungen des Chromatins knnen daher als Signa-turen verstanden werden, die definierte Bereiche des Ge-noms markieren und Gene an- oder abschalten. Da be-stimmte Chromatin-Vernderungen offenbar mit definier-ten Genexpressionsmustern korrelieren, haben Strahl &Allis das Prinzip eines Epigenetischen Codes vorgeschla-gen, der sozusagen dem genetischen Code aufliegt [3].

    Chromatinplastizitt reguliert kognitiveFunktionen

    Neuere Arbeiten an Nagern deuten darauf hin, dass dieChromatin-Plastizitt wesentlich zur Gedchtniskonsolidie-rung beitrgt. Lernen und Gedchtnisprozesse knnen inRatten und Musen durch eine Reihe von etablierten Verhal-tenstests untersucht werden.

    Die Gedchtniskonsolidierung in diesen Tests erfordertunter anderem Genexpression und De-novo-Proteinsynthe-se im Hippokampus, einer Hirnregion des limbischen Sys-tems, welche auch beim Menschen essentiell fr Lernpro-zesse ist. Interessanterweise konnte gezeigt werden, dassdie Gedchtniskonsolidierung mit einer transienten Hoch-regulierung der hippokampalen Histon-Acetylierung korre-liert.

    Ratten weisen, nachdem sie einem Lernparadigma aus-gesetzt wurden, eine Stunde spter eine transient erhhteH3-Acetylierung im Hippokampus auf. Diese Befunde konn-ten mittlerweile in Musen reproduziert werden. Die tran-sient erhhte H3-Acetylierung beruht auf der Aktivierungvon synaptischen NMDA-Rezeptoren und der Aktivitt desMAP-Kinase-Signalwegs. In Einklang mit diesen Ergebnissenkonnte gezeigt werden, dass genetische Mausmodelle mitvernderter HAT-Aktivitt Lerndefizite aufweisen. So fhrtz.B. eine vermindertet Aktivitt des CREB (cAMP responseelement binding factor)-Bindeproteins (CBP) zu reduzier-ter hippokampaler Histon-Acetylierung und deutlichen De-fiziten in der Furchtkonditionierung, dem Wasser-Labyrinth-Test und im Objekt-Erkennungstest [47]. Interessanter-weise konnte gezeigt werden, dass diese Lerndefizite durcheine Erhhung der Histon-Acetylierung ausgeglichen wer-den konnten. Die Histon-Acetylierung wurde dabei durchdie Verabreichung von HDAC-Inhibitoren erreicht. Erstaun-licherweise fhrte die Gabe von HDAC-Inhibitoren im Ver-gleich zur Placebo-behandelten Gruppe auch in Wildtyp-Musen und Ratten zu einer deutlich verbesserten Gedcht-niskonsolidierung.

    Zusammenfassend zeigen diese Arbeiten, dass dieHiston-Acetylierung ein wichtiger Mechanismus der Ge-dchtniskonsolidierung ist und dass HDAC-Inhibitorenpotentielle Therapeutika fr kognitive Erkrankungen seinknnten.

    HDAC-Inhibitoren als therapeutische Strategiefr neuronale Erkrankungen

    Es gibt elf HDAC-Proteine, die aufgrund von Homologien indrei Klassen eingeteilt werden. Die Klasse I HDACs (HDAC1, HDAC 2, HDAC 3 und HDAC 8) sind hauptschlich imZellkern lokalisiert, wohingegen die Klasse-II-HDACs (HDAC5, HDAC 6, HDAC 7, HDAC 9, HDAC 10) durch zustzlicheregulatorische Domnen deutlich grer sind und sowohlim Zytoplasma als auch im Zellkern zu finden sind. HDAC11 ist bisher der einzige Vertreter der Klasse-IV-HDACs.HDACs der Klassen I, II und IV bentigen Zink als Cofak-tor. Daneben gibt es noch sieben, als Sirtuine bezeichneteKlasse-III-HDACs, die NAD+ als Cofaktor brauchen.

    2010 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim www.pharmuz.de 3/2010 (39) | Pharm. Unserer Zeit | 205

  • Die meisten derzeit zur Verfgung stehenden Substan-zen sind pan-HDAC-Inhibitoren, welche eher unselektiv al-le elf HDAC-Proteine hemmen (Abb. 2). Die HDAC-Inhibi-toren knnen im Wesentlichen in vier Gruppen eingeteiltwerden: kurzkettige Fettsuren wie z.B. Natriumbutyrat (NaB)

    oder Valproat; Hydroxamate wie z.B. Suberoylanilid-Hydroxamsure

    (SAHA, INN: Vorinostat, Zolinza) oder Trichostatin A(TSA);

    zyklische Tetrapeptide wie Apicidin; Benzamide wie MS-275 (INN: Entinostat). Diese Inhibitoren zeigen in prklinischen Versuchen deut-liche neuroprotektive und neuroregenerative Eigenschaften(Tab. 1) und einige werden nachfolgend detaillierter vor-gestellt.

    Rubinstein-Taybi-SyndromRubinstein-Taybi-Syndrom (RTS) ist eine autosomal-domi-nant vererbte Erkrankung und fhrt zu mentaler Retardie-rung. Die hauptschlichen Ursachen fr RTS sind Mutatio-nen des CBP-Proteins, was in einer reduzierten HAT-Aktivi-tt und verminderten Histon-Acetylierung resultiert.Heterozygote CBP+/-Muse weisen eine Reihe von charak-teristischen Merkmalen fr RTS auf, so z.B. verschlechter-te kognitive Eigenschaften. Interessanterweise konnte durchdie Verabreichung von Vorinostat Defizite in der Histon-Acetylierung ausgeglichen und synaptische Plastizitt undLernvermgen in CBP+/-Musen wieder hergestellt werden[8].

    Chorea HuntingtonChorea Huntington (CH) ist eine autosomal-dominant ver-erbte neurodegenerative Erkrankung. Aufflligste Symp-tome sind Bewegungsstrungen und kognitive Defizite. Als

    Ursache sind Mutationen des Proteins Huntingtin (Htt) an-zusehen, bei denen sich die Basentriplett-Sequenz CAG ab-normal oft wiederholt. Die genaue Wirkungsweise von mu-tiertem Huntingtin ist nicht eindeutig geklrt, aber es fhrtunter anderem zu einer Deregulation der neuronalen Gen-expression, was vor allem auf eine Inhibierung der CBP-Ak-tivitt zurckzufhren ist. Tatschlich konnten mehrere Stu-dien in Mausmodellen zeigen, dass die Behandlung mit denHDAC-Inhibitoren Vorinostat bzw. NaB neuroprotektivwirkt und kognitive und motorische Fhigkeiten verbes-sert.

    CH korreliert auch mit einem Defizit neurotropher Fak-toren wie z.B. BDNF (brain-derived neurotrophic factor).Tatschlich konnte in Zellkulturexperimenten gezeigt wer-den, dass das Htt-Protein den BDNF-Transport verhindert.Durch HDAC6-Inhibitoren konnte der BDNF-Transport nor-malisiert werden. HDAC6 desacetyliert unter anderem Mi-krotubuli und beeinflusst dadurch den neuronalen Trans-port. Ein deregulierter axonaler Transport ist nicht nur inCH, sondern auch in anderen neurodegenerativen Erkran-kungen wie z.B. Alzheimer zu beobachten. Interessanter-weise zeigten HDAC-Inhibitoren wie Entinostat oder 4-Phe-nylbutyrat, die nicht HDAC6 hemmen, keinen protektivenEffekt, was darauf hinweist, das die Pathologie von CH mitspezifischen Vernderungen der Chromatin-Plastizitt undMikrotubuli-Dynamik einhergeht.

    Friedreichs AtaxieDie Friedreichs Ataxie (FA) ist eine autosomal-rezessiv ver-erbte neurodegenerative Erkrankung, die auf Mutationendes FRDA-Gens beruht. FRDA codiert fr das mitochon-driale Protein Frataxin. Dabei treten in einem Intron desFRDA-Gens abnormal viele GAA-Tripletts auf, welche letzt-lich zu einer deutlich verminderten Expression des FRDA-Gens fhren. Zustzlich weist das FRDA-Gen in Patienten imPromotorbereich eine stark verminderte H3/H4-Acetylie-rung und H3K9-Trimethylierung auf, so dass die damit ein-hergehende Heterochromatinstruktur die Genexpressionzustzlich verhindert. Herman et al. [9] konnten zeigen,dass im FA-Modell HDAC-Inhibitoren die Histon-Acetylie-rung des FRDA-Locus erhhen und die FRDA-Expressionnormalisieren. Allerdings hatten herkmmliche pan-HDAC-Inhibitoren wie Vorinostat oder TSA keinen Effekt, wohin-gegen neue HDAC-Inhibitoren wie die Substanz 4b im Pro-motorbereich des FRDA-Gens Histon-Acetylierung und dieGenexpression erhhten.

    Spinale Muskelatrophie Die Spinale Muskelatrophie (SMA) ist eine degenerative Er-krankung der Motoneuronen, bei denen die Expression desSMN1- und SMN2-Gens (SMN: surivial motor neuron 1) re-duziert sind. Dabei bestimmt insbesondere der Gehalt anSMN2 den Grad der Pathogenese. Interessanterweise konn-te gezeigt werden, dass in SMA-Patienten der Promotor desSMN2 Gens hypermethyliert ist und vermutlich berMeCP2-Bindung die Genexpression reprimiert. HDAC-Inhi-

    206 | Pharm. Unserer Zeit | 3/2010 (39) www.pharmuz.de 2010 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim

    A B B . 2 H DAC- I N H I B I TO R E N Z U R T H E R A PI E N E U RO N A L E R

    E R K R A N KU N G E N

    Klasse I Klasse IIa

    Klasse IIbKlasse IV

    HDAC11

    HDAC1

    HDAC2

    HDAC3

    HDAC8

    HDAC4

    HDAC5

    HDAC7

    Klasse IIb

    HDAC9

    HDAC6

    HDAC10

    MS-275 (Entinostat)Romidepsin (Istodax)

    NatriumbutyratValproat

    4-Phenylbutyrat

    Trichostatin ASuberoylanilid-Hydroxamsure

    (Vorinostat, ZolinzaTM)Tubacin

    4b

    Das Schema zeigt die Spezifitt von HDAC-Inhibitoren, die im Kontext neuronalerKrankheiten experimentell getestet wurden.

  • T H E R A P I E F R N E U R O N A L E E R K R A N K U N G E N | K L I N I K

    bitoren knnen dazu beitragen, ber indirekte Effekte einedurch DNA-Methylierung vermittelte Genrepression aufzu-heben. Tatschlich konnte gezeigt werden, dass die HDAC-Inhibitoren Vorinostat und Romidepsin die Expression vonSMN2 erhhen, wohingegen 4-Phenylbutyrat und Valproatkeinen Effekt zeigten. In einer hnlichen Studie konnte ge-zeigt werden, dass der HDAC-Inhibitor TSA ebenfalls dieSMN2-Expression erhhen kann

    Amyotrophe laterale SkleroseAmyotrophe laterale Sklerose (ALS) ist eine neuro-degenerative Erkrankung, die mit einem progressiven Ver-lust von Motoneuronen einhergeht. Zumindest in 20 % derKrankheitsflle kann die Pathogenese auf Mutationen imSOD1-Gen zurckgefhrt werden. SOD1/G93A-Muse sinddaher ein bevorzugtes Tiermodell, um ALS zu untersuchen.Interessanterweise konnte in diesem Modell gezeigt wer-den, dass sich die Behandlung mit 4-Phenylbutyrat (4-PB)deutlich positiv auf die Pathogenese auswirkte und vor al-lem zur Hochregulierung neuroprotektiver Faktoren fhr-te. hnliche, aber nicht ganz eindeutige Befunde wurdennach Valproat-Behandlung beobachtet.

    Morbus ParkinsonMorbus Parkinson (PD) ist durch den selektiven Verlust do-paminerger Neurone in der Substantia Nigra charakterisiert.Als Folge kommt es zu B...

Recommended

View more >